Datasheet is currently unavailable. Try again or CONTACT US
Datasheet

DLAT Antibody

Rabbit Polyclonal

ABIN629688
100 µg
Lyophilized
WB, IHC
Human, Mouse, Rat, Dog
Rabbit
$775.00 /Per Item
Availability: Ships in approximately 14 days
Shipping info:

$50.00 to US & $70.00 to Canada for most products. Final costs are calculated at checkout.

Product Details

Anti-Dihydrolipoyl Transacetylase (DLAT) Antibody - ABIN629688
DLAT, Dmel\\CG5261, EP(2)0816, EP816, anon-WO0118547.121, DLTA, PDC-E2, PDCE2, wu:fc14f10, wu:fc21f08, wu:fc86g11, wu:fj57d06, 6332404G05Rik, midline uncoordinated, dihydrolipoamide S-acetyltransferase L homeolog, dihydrolipoamide S-acetyltransferase, dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex), muc, dlat.L, DLAT, Dlat, dlat
Rabbit
Polyclonal
IgG

Target Details

DLAT  - View All DLAT Products
Human, Mouse, Rat, Dog
Conjugated Peptide
DLAT antibody was raised using a synthetic peptide corresponding to a region with amino acids WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR.
Anti-DLAT antibody has been purified and is reactive to Human, Mouse, Rat, and Dog.
P10515 - UniProtKB
1737 - Gene ID

Application Details

IHC, WB
DLAT antibody is tested by Immunohistochemistry (IHC), Western Blotting (WB). Expect a band ~71 kDa in size corresponding to DLAT by western blotting in the appropriate cell lysate or extract. Optimal conditions should be determined by the investigator.

Formulation

0.02 M Potassium Phosphate, 0.15 M Sodium Chloride, pH 7.2
100 µL
Restore with deionized water (or equivalent)

Shipping & Handling

Ambient
Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Expiration date is one (1) year from date of receipt.
DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.

Invalid lot number

If you need help finding your CoA, contact us

This product is for research use only and is not intended for therapeutic or diagnostic applications. Please contact a technical service representative for more information. All products of animal origin manufactured by Rockland Immunochemicals are derived from starting materials of North American origin. Collection was performed in United States Department of Agriculture (USDA) inspected facilities and all materials have been inspected and certified to be free of disease and suitable for exportation. All properties listed are typical characteristics and are not specifications. All suggestions and data are offered in good faith but without guarantee as conditions and methods of use of our products are beyond our control. All claims must be made within 30 days following the date of delivery. The prospective user must determine the suitability of our materials before adopting them on a commercial scale. Suggested uses of our products are not recommendations to use our products in violation of any patent or as a license under any patent of Rockland Immunochemicals, Inc. If you require a commercial license to use this material and do not have one, then return this material, unopened to: Rockland Inc., P.O. BOX 5199, Limerick, Pennsylvania, USA.